The domain within your query sequence starts at position 415 and ends at position 612; the E-value for the JAKMIP_CC3 domain shown below is 3.3e-85.

ERERLLRSKRHRGKSLKPPKKHVVETFFGFDEESVDSETLSETSYNTDRTDRTPATPEED
LDETTTREEADLRFCQLTREYQALQRAYALLQEQVGGTLDAEREARTREQLQADLLRCQA
KIEDLEKLLVEKGQDAAWVEEKQVLMRTNQDLLEKIYRLEMEENQLKSEMQDAKDQNELL
EFRVLELEERERRSPAFN

JAKMIP_CC3

JAKMIP_CC3
PFAM accession number:PF16034
Interpro abstract (IPR031994):

This domain is found at the C terminus of proteins belonging to the JAKMIP family (Janus kinase and microtubule-interacting proteins) and is predicted to be a coiled coil. It interacts with the Janus family kinases Tyk2 and Jak1 [(PUBMED:15277531), (PUBMED:17532644), (PUBMED:14718537)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry JAKMIP_CC3