The domain within your query sequence starts at position 1 and ends at position 1309; the E-value for the JCAD domain shown below is < 1e-12.

MYSVEDLLISHGYKPARDAAAPCEDKSERCRSTRTGPRAGQGLLNGYKDGATAHTHSRTS
LGTGHVSNSENRISRPRGHREHQSTSRTPEARFLNQPSLAWSSQPQSGRDDIYWSRGRQE
GSGSLCPRDWKELESRGMAQAYSLPVHVRENLWEVAGRTEHVMKNAIWEEELRMQDMSLE
SWKKPRELGRQASDGDGRKRPQEKFEGLYPFVHGEHTSQNRKKSQSLPRALSPKSLNFTE
IPVPLHDGHITGVPKVPPYPPSFPSPSEPMRNLEKASSSGPFPRPKFGKPLKTPCYSSHS
QPRGEGGFQDHQHRDPRGSYPTRSKDPSHELGMLDPGLEPPVYVPPPSYRSPPQHIPNPY
LEDPVPRHVSSNQSQQQVPEKPETSCPLPSGSLAARDLYDAMPGSPPQGLPPQPYPIATH
GGSIQYIPFDDPRIRHIKLAQPPEFYEEAKLDDTSYNPGLLTTQEPAIGKRQYDDAPSVP
RGPTPSPVNEQSSAFVHSSPRWLQGQLPLGIGPGGFHGQTEHHVMGGLTTNVTDIKAEGH
ASSPQPQSEGTCKTYTKLRKFETGVQSKKSSKKKSNATIFCLVSIPVKSESLVLATDTNN
NDFKLVADKTRGLCQGSALQEQSLLSMSSTDLELQALMGSMAWRRTSPRQGLRESEDGQI
DDPRILHLIKPKELQASSPWPGHQYRDQQTQTSFHEDSKSSQLLPATKPGEASNVAPTPT
CPDTTASEVCLHTALAFSDQNQKPSVPHLQGQTSLSPSRNSAFSRTSSAINQASMSKGTS
DQLPGANPVPKPEVVKGESTTGQCNSTQLFGQFLLKPVSRRPWDLISQLESFNKELQEEE
ESHGGSGSEDSEAEQPEDCADSRTKSWALQGTRTAQQPAGLALENVASPDRRLNDSQSWN
EEPKPGHSSVHPQSLGPSQEEGSRGVPVQWADGSLTAEQKSQEDLNGMCERDFSPRPVSR
IAPIDTKAAPLYCLSEPRGSQELTKFGDAVGSVQLGRETPTQVGNGGDTEVLPCVLLPLA
DKYRGHSTPDFRSLELTLGQEQNAYKLECLDLENTVEVLPSESLQERAERILGIEVAVES
LLPSARRTEQSQLPEPDASACNPSSSREDSSHSLALPVGPKVATDAFYGRRKCGWTESPL
FVGERAPQASICSDVDGFPTSQATSPEPGKKDEEAKAPFKSTLFHFMEKSTNVVGPEKRL
RNPSKVVENLQEKLVSPPKKADSVHLIRMREVNSLSQMRCLSSKSADSVEEPDPLKVIKS
SAWLSEGLTSLGGKDEAWQAGHLPSVSQNENGHPEVPRDKMSDQDLWCA

JCAD

JCAD
PFAM accession number:PF15351
Interpro abstract (IPR028221):

Junctional protein associated with coronary artery disease (JCAD) is a component of VE-cadherin-based cell-cell junctions in endothelial cells [(PUBMED:21884682)]. The cell-cell or adherens junction is an adhesion complex that plays a crucial role in the organisation and function of epithelial and endothelial cellular sheets. These junctions join the actin cytoskeleton to the plasma membrane to form adhesive contacts between cells or between cells and extracellular matrix. The junctions also mediate both cell adhesion and cell-signalling. JCAD localises close to the apical membrane in epithelial cells.

GO component:cell-cell junction (GO:0005911)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry JCAD