The domain within your query sequence starts at position 423 and ends at position 493; the E-value for the JIP_LZII domain shown below is 3.1e-32.

FGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLE
NRIKELEEELK

JIP_LZII

JIP_LZII
PFAM accession number:PF16471
Interpro abstract (IPR032486):

This is the second leucine zipper domain (LZII) of several JNK-interacting proteins (JIP). It interacts with the small GTP-binding protein ARF6 [(PUBMED:19644450)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry JIP_LZII