The domain within your query sequence starts at position 79 and ends at position 138; the E-value for the JSRP domain shown below is 1e-29.

DDLPWGDLTLNKCLVLASLVALLGSALQLCRDAVAGEVVAAPHPWVPPSSPPKKEASPAP

JSRP

JSRP
PFAM accession number:PF15312
Interpro abstract (IPR026178): Junctional sarcoplasmic reticulum protein 1 (JSRP1, also known as JP-45) may regulate voltage-sensitive calcium channel CACNA1S membrane targeting and activity [(PUBMED:16638807)]. The protein may also have a role in the development or maintenance of skeletal muscle strength [(PUBMED:18077436)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry JSRP