The domain within your query sequence starts at position 30 and ends at position 95; the E-value for the JTB domain shown below is 1.2e-32.

AEAPVREEKLSVSTSTSPCWLAEEFVVTEECTPCSNFQIKTTPECGSTGYVEKITCSSSK
RNEFKR

JTB

JTB
PFAM accession number:PF05439
Interpro abstract (IPR008657): This family contains several jumping translocation breakpoint proteins or JTBs. Jumping translocation (JT) is an unbalanced translocation that comprises amplified chromosomal segments jumping to various telomeres. JTB, located at 1q21, has been found to fuse with the telomeric repeats of acceptor telomeres in a case of JT. hJTB (Homo sapiens JTB) encodes a transmembrane protein that is highly conserved among divergent eukaryotic species. JT results in a hJTB truncation, which potentially produces an hJTB product devoid of the transmembrane domain. hJTB is located in a gene-rich region at 1q21, called EDC (Epidermal Differentiation Complex) [(PUBMED:10321732)]. JTB has also been implicated in prostatic carcinomas [(PUBMED:10762645)].
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry JTB