The domain within your query sequence starts at position 1 and ends at position 40; the E-value for the Jagunal domain shown below is 2.5e-18.
MASRAGPRAAGTDGSDFQHRERVAMHYQMRYECDPQVRNQ
Jagunal |
---|
PFAM accession number: | PF07086 |
---|---|
Interpro abstract (IPR009787): | Protein jagunal is required for endoplasmic reticulum organisation and proper vesicular traffic during Drosophila oogenesis [ (PUBMED:17389229) ]. |
GO process: | endoplasmic reticulum organization (GO:0007029) |
GO component: | endoplasmic reticulum membrane (GO:0005789) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Jagunal