The domain within your query sequence starts at position 10 and ends at position 186; the E-value for the Jiraiya domain shown below is 1e-50.

LAAMTLLGIPAAVLVALAAQLLFQLQAGRAELRRVRTDGLHPELDPDAGLPEAAAGALLP
LATALAALAQVLGLSCLLLAALCGHLGAELARGPGPGRSDWFLYDCRLLRHSALGLFCCG
VSVYLAALAIYALLLFEIEAGAAAASILGSGALILVAIMTHTLFRAVQATRRGLREL

Jiraiya

Jiraiya
PFAM accession number:PF15038
Interpro abstract (IPR029201):

The membrane protein Jiraiya from Xenopus inhibits bone morphogenetic protein (BMP) signalling during embryogenesis [(PUBMED:20951346)]. The human member of this family is uncharacterised protein TMEM221 (transmembrane protein 221).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Jiraiya