SMART: Pfam domain Jiv90

The domain within your query sequence starts at position 532 and ends at position 621; the E-value for the Jiv90 domain shown below is 5.9e-40.

AMNTMMCSRCQGKHRRFEMDREPKSARYCAECNRLHPAEEGDFWAESSMLGLKITYFALM
DGKVYDITEWAGCQRVGISPDTHRVPYHIS

Jiv90

PFAM accession number:	PF14901
Interpro abstract (IPR032843):	This entry represents Jiv (J-domain protein interacting with viral protein), a domain found in the DnaJ protein from eukaryotes [ (PUBMED:11533209) ]. It can also be found in the N-terminal region of the pestivirus viral polypeptide. The viral protein interacts stably with non structural (NS) protein NS2, causing a conformational change in NS2-NS3 and stimulates NS2-NS3 cleavage in trans. Cleavage of NS2-NS3 increases cytopathogenicity and consequently aids viral replication. Jiv therefore acts as a regulating cofactor for NS2 auto-protease. The efficient release of NS3 from the viral polypeptide by Jiv is considered crucial to the pestivirus cytopathogenicity [ (PUBMED:12970452) ]. In eukaryotes, it usually lies 40 residues downstream of DnaJ domain ( IPR001623 ). However, the function of this domain in eukaryotes is still unknown.

PFAM accession number:

PF14901

Interpro abstract (IPR032843):

This entry represents Jiv (J-domain protein interacting with viral protein), a domain found in the DnaJ protein from eukaryotes [ (PUBMED:11533209) ]. It can also be found in the N-terminal region of the pestivirus viral polypeptide. The viral protein interacts stably with non structural (NS) protein NS2, causing a conformational change in NS2-NS3 and stimulates NS2-NS3 cleavage in trans. Cleavage of NS2-NS3 increases cytopathogenicity and consequently aids viral replication. Jiv therefore acts as a regulating cofactor for NS2 auto-protease. The efficient release of NS3 from the viral polypeptide by Jiv is considered crucial to the pestivirus cytopathogenicity [ (PUBMED:12970452) ]. In eukaryotes, it usually lies 40 residues downstream of DnaJ domain ( IPR001623 ). However, the function of this domain in eukaryotes is still unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Jiv90