The domain within your query sequence starts at position 27 and ends at position 175; the E-value for the Jnk-SapK_ap_N domain shown below is 2.3e-47.
VYDIASLVGHEFERVIDQHGCESIARLMPKVVRVLEILEVLVSRHHVAPELDELRLELDR LRVERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLNHKDVGFSE EEFQKQEGMSERERQVMKRLKEVVDKQRD
Jnk-SapK_ap_N |
---|
PFAM accession number: | PF09744 |
---|---|
Interpro abstract (IPR019143): | This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans. Most of the proteins in this entry have a RhoGEF domain ( IPR000219 ) at their C-terminal end. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Jnk-SapK_ap_N