The domain within your query sequence starts at position 2894 and ends at position 3207; the E-value for the Joubert domain shown below is 1.9e-136.

QLQVTGLTDIADIIGDLITKSGVSSHELGLTECQARSISRIQRPPDRGPRRTAEERREIK
AWMRRKQKERMSEYLGQLAERRGRERNPFCPTSSPFYMTSRQIRQRQKMKREKDRLQLSK
HYSQRLSQAYSLMNELLSDSAHITAPAENPLPPGPYRRQRGSSPKRENAHGQSLPVNRPG
GDRHISRSSHLCKGQPRGSSQLRGSQPPCQSQKPLRSRGAAGVGPPVQQACREDEREEMV
VSPWTLPSEIHRILHGRPESLLQDMSPADEEEPEPPLLAGGMDSVSESTGSILSKLDWKA
VEDMVASVEDKNLS

Joubert

Joubert
PFAM accession number:PF15392
Interpro abstract (IPR028236):

This family of proteins, which is found in eukaryotes, has no known function. However, mutations in the gene lead to Joubert's Syndrome, a ciliopathy characterised by a distinctive mid-hindbrain malformation, developmental delay with hypotonia, ocular-motor apraxia, and breathing abnormalities [(PUBMED:22425360), (PUBMED:25877302)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Joubert