The domain within your query sequence starts at position 5 and ends at position 244; the E-value for the Jun domain shown below is 6.5e-89.

METTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSP
DVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQ
NTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGALSSG
GGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETPP

Jun

Jun
PFAM accession number:PF03957
Interpro abstract (IPR005643):

The c-Jun NH(2)-terminal kinase (JNK) is a member of an evolutionarily conserved sub-family of mitogen-activated protein (MAP) kinases [(PUBMED:11402333), (PUBMED:11790549)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Jun