The domain within your query sequence starts at position 100 and ends at position 1061; the E-value for the K1377 domain shown below is < 1e-12.

QQRKQKFEEVTEKFQRAHVPVSQRRRAVFQNPVPPLEEALKQIQESNLKSEVNIPLFHRP
ATNWRAIDSALPSTLSKNDHKHQKHLVRRINRNKEMKENNIANLATNKNVFQLKLEETQK
LLEDQHLSDLQKFCDEVNQITNSETLSSIDSLEAGEREEIYITLSMKPSTSTQQNSVPLQ
SANLQAAHLDCFDEDKLSFSKTQHINNWLTNLDAQNSQPVASFSDILIKSNVLPSWECLN
SKEQNPPALSRTVGRTTRTTSDSMVFVCSPSVVALDKKGENTAESNVVRASDPTEGAVQR
ERPAQMESPTFKVSRAWTTAESLTQETASFSVQERPSELTWESRTASIPASSVTVLSPNL
QAGGPLAENNTQIKEIDPVQCSDKLDELKNMEHERINHLNCNKEKYLFSPNFQTTCALQN
SNSNDRKQKESGPSAALCNNPPDCDLPEQHSIKHSVHEQNGVRLLKSILKKESRYEHNYL
RALVMKQGFKFRHQKAETVRDSIELTKQKGKGAEISKTSKKLRWFDESANLENAVDDCHP
VRNRAGMAPRWLQRCHTNSGTYNLTSIPECPVHSAAGKKAKADSVPENATDLGRYEIDSV
PLNSSVSLGFSFAKQAWSACRRGESKAPVHASDSKTQKTKPQRGVKFTRRTGSSKVQKGL
VQNRKPTVSQPQTSSKANTVAQTQGKLIITHPPPKPPTNIKSGKNMQVSPGQSAIPEHSQ
NVMTQSCLSPASVLPTEYHLNQGTQESSLPFSDTCSNLPAVSPALPTPYSSECQTLAKAN
SNGTAFLKDGAVYCTHRSPVCEESYQSFTHRNTEEESILPWRRRINGHQNERTTDSTVTR
RKQIVENKWKRLLEQKRKTSGSIGMKYTEQITHFGQNVPPSTTEQIQAPRGVKTEEVSDS
TSEFLVAENLMNSSVPEDEILTAINSKHLQKPNLSQPTNVCALSAEEQKILKSLHHLDER
LY

K1377

K1377
PFAM accession number:PF15352
Interpro abstract (IPR028257):

Centrosomal protein of ~126 kDa (CEP126), previously known as KIAA1377 [(PUBMED:22264561)], localises to the centrosome, pericentriolar satellites and the base of the primary cilium. It is an important regulator of centrosomal function. Cep126 is necessary for microtubule (MT) organisation, association of the MT array with the centrosome, and is also required for the formation of the primary cilium [(PUBMED:24867236)].

GO process:non-motile cilium assembly (GO:1905515), cytoplasmic microtubule organization (GO:0031122), mitotic spindle organization (GO:0007052)
GO component:centrosome (GO:0005813), ciliary base (GO:0097546)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry K1377