The domain within your query sequence starts at position 889 and ends at position 982; the E-value for the K167R domain shown below is 1.5e-9.

RKQKPTKDLLGSQMVTQTADYAEELLSQGQGTIQNLEESMHMQNTSISEDQGITEKKVNI
IVYATKEKHSPKTPGKKAQPLEGPAGLKEHFETP

K167R

K167R
PFAM accession number:PF08065
Interpro abstract (IPR012568):

This entry represents the KI67/Chmadrin repeat [(PUBMED:15112237)]. It can be found in the human antigen KI-67 protein [(PUBMED:8227122)]. The function of this repeat is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry K167R