The domain within your query sequence starts at position 362 and ends at position 474; the E-value for the KAsynt_C_assoc domain shown below is 8.2e-46.

PNPEIPALLDGRLQVVDRPLPVRGGNVGINSFGFGGSNVHVILQPNTRQAPAPTAHAALP
HLLHASGRTLEAVQDLLEQGRQHSQDLAFVSMLNDIAATPTAAMPFRGYTVLG

KAsynt_C_assoc

KAsynt_C_assoc
PFAM accession number:PF16197
Interpro abstract (IPR032821):

This entry represents the very C terminus of a subset of proteins from the keto-acyl-synthetase 2 family. It is found in proteins ranging from bacteria to human.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry KAsynt_C_assoc