The domain within your query sequence starts at position 243 and ends at position 610; the E-value for the KBP_C domain shown below is 6.6e-124.

MEWAINAATLSQFYINKLCFMEARHCLSAANVIFGQTGKIPATEDTPEVEGDVPELYHQR
KGEIARCWIKYCLTLMQNAQLSMQDNIGELDLDKQSELRALRKKELDEEESVRKRAVQFG
TGELCDAISAVEEKVRYLRPLDFEEARELFLLGQHYVCEAKEFFQIDGYVTDHIEVVQDH
SALFKVLSFFEADMERRCKMHKRRIAMLEPLTVDLNPQYYLLVSRQIQFEIAHAYYDMMD
LKVAIADKLRDPDSHIVKKINSLNKSALKYYQLFLDSLRDPNKVFPEHIGEDVLRPAMLA
KFRVARLYGKIITADPKKELENLATSLEHYKFIVDYCETHPEAAQEIEVELELSKEMVSL
LPTKMERF

KBP_C

KBP_C
PFAM accession number:PF12309
Interpro abstract (IPR022083):

KIF1 binding protein (KBP) is a binding partner for KIF1Balpha that is a regulator of its transport function and thus represents a type of kinesin interacting protein [(PUBMED:16225668)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry KBP_C