The domain within your query sequence starts at position 1 and ends at position 211; the E-value for the KIAA1328 domain shown below is 9.6e-81.
MDLDGSFLSVARPQNYGQTKARPKSANQVSESFTELRNNSLRPITLHHPKEDLERMSTKT RTCTYESLGRRLINAAPIEKSLPVELKIKEYPNLPPTPSSQYCGHKCSESGAYVHENYHP TNMAPQCCKTHPESCSHCRIPWASQMHDRVILQPRETDIEKQLSEDRRQQLMLQKMELEI EKERLQHLLAQQETKLLLKQQQLHQSRLDYN
KIAA1328 |
---|
PFAM accession number: | PF15369 |
---|---|
Interpro abstract (IPR032736): | Protein hinderin shares structural similarity to the SMC family members. It interacts with SMC3 and may affect the availability of SMC3 to engage in the formation of multimeric protein complexes [ (PUBMED:15656913) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry KIAA1328