The domain within your query sequence starts at position 92 and ends at position 414; the E-value for the KIAA1328 domain shown below is 1.6e-160.

DLCLEDKRRIANLIKELARVSEEKEVTEERLKTEQESFEKKIRQLEEQNELIIKEREELQ
LQYRECQELLSLYQKYLSEQQEKLTLSLSELGAARAQEQQITKKKNTPQCSLMDLDGSFL
SVARPQNYGQTKARPKSANQVSESFTELRNNSLRPITLHHPKEDLERMSTKTRTCTYESL
GRRLINAAPIEKSLPVELKIKEYPNLPPTPSSQYCGHKCSESGAYVHENYHPTNMAPQCC
KTHPESCSHCRIPWASQMHDRVILQPRETDIEKQLSEDRRQQLMLQKMELEIEKERLQHL
LAQQETKLLLKQQQLHQSRLDYN

KIAA1328

KIAA1328
PFAM accession number:PF15369
Interpro abstract (IPR032736): Protein hinderin shares structural similarity to the SMC family members. It interacts with SMC3 and may affect the availability of SMC3 to engage in the formation of multimeric protein complexes [(PUBMED:15656913)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry KIAA1328