The domain within your query sequence starts at position 352 and ends at position 457; the E-value for the KIAA1430 domain shown below is 4.4e-21.

MDLNHLLKAFLQLDKKGPQKHHFEQPAIIPRKNYSFTREEVRQIDRENQRLLKELSRQAE
KPGSKSTIPGRSIGHPPKLYHSALNRQREQQRIERENMALLKRLEA

KIAA1430

KIAA1430
PFAM accession number:PF13879
Interpro abstract (IPR029488):

Drosophila Hemingway (Hmw) is required for motile cilia function and sperm flagella assembly [(PUBMED:24554765)]. The human orthologue, known as cilia- and flagella-associated protein 97 (CFAP97) or KIAA1430, localizes to the primary cilium [(PUBMED:26638075)]. Another member of this family is the uncharacterized protein CFAP97D1 (CFAP97 domain-containing protein 1).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry KIAA1430