The domain within your query sequence starts at position 615 and ends at position 654; the E-value for the KIF1B domain shown below is 1.3e-7.
ELKVKNLASSDSRGYDLQKEVMVKVTKQGTHEVWIWSKAK
KIF1B |
---|
PFAM accession number: | PF12423 |
---|---|
Interpro abstract (IPR022140): | This domain is found in kinesin-like proteins and is approximately 50 amino acids in length. It is found in some kinesin-3 family members, such as KIF1, KIF13, KIF28 [ (PUBMED:24706892) ] and unc-104 [ (PUBMED:17643120) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry KIF1B