The domain within your query sequence starts at position 27 and ends at position 206; the E-value for the KOG2701 domain shown below is 2e-81.

LTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCSFDVDVDLLFQENSTIGQKIAL
SEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSISQF
QKTYSLPEDDDFIKRKDKAVKTVVGLSDAYKPRRKYRRQRGAEELPDEESRVHSTLLEYG

KOG2701

KOG2701
PFAM accession number:PF09762
Interpro abstract (IPR019159):

This coiled-coil domain conserved from plants to vertebrates. It is found in Drosophila fidipidine, whose function is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry KOG2701