The domain within your query sequence starts at position 177 and ends at position 211; the E-value for the KOW domain shown below is 4.3e-8.

TGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVK

KOW

 KOW
PFAM accession number:PF00467
Interpro abstract (IPR005824):

The KOW (Kyprides, Ouzounis, Woese) motif is found in a variety of ribosomal proteins and the bacterial transcription antitermination proteins NusG [ (PUBMED:8987397) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry KOW