The domain within your query sequence starts at position 54 and ends at position 105; the E-value for the KOW domain shown below is 7.2e-8.
EVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVIT
KOW |
---|
PFAM accession number: | PF00467 |
---|---|
Interpro abstract (IPR005824): | The KOW (Kyprides, Ouzounis, Woese) motif is found in a variety of ribosomal proteins and the bacterial transcription antitermination proteins NusG [ (PUBMED:8987397) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry KOW