The domain within your query sequence starts at position 23 and ends at position 77; the E-value for the KRTDAP domain shown below is 2.4e-23.

AALGHPTIYPEDSSYNNYPTATEAFQSENFLNWHVITDMFKNAFPFINWDFFPKT

KRTDAP

KRTDAP
PFAM accession number:PF15200
Interpro abstract (IPR028196):

Keratinocyte differentiation-associated protein (KRTDAP) is secreted by keratinocytes and may serve as a soluble regulator of keratinocyte differentiation [ (PUBMED:15140226) ].

GO component:extracellular region (GO:0005576)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry KRTDAP