The domain within your query sequence starts at position 1 and ends at position 46; the E-value for the KSR1-SAM domain shown below is 5.9e-13.

MQEIPQELTLDALLEMDEAKAKEMLRRWGASTEECSRLQQALTCLR

KSR1-SAM

KSR1-SAM
PFAM accession number:PF13543
Interpro abstract (IPR025561): This SAM-like domain is found in kinase suppressor of Ras proteins, which are location-regulated scaffolding proteins connecting MEK to RAF.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry KSR1-SAM