The domain within your query sequence starts at position 94 and ends at position 190; the E-value for the K_oxygenase domain shown below is 5.2e-7.

LQGGEALPFSHLILATGSTGPFPGKFNEVSCQQAAIQAYEDMVKQIQRSQFIVVVGGGSA
GVEMAAEIKTEYPEKEVTLIHSRVPLADKELLPCVRQ

K_oxygenase

K_oxygenase
PFAM accession number:PF13434
Interpro abstract (IPR025700):

This is a family of Rossmann fold oxidoreductases that catalyse NADPH-dependent hydroxylation and are involved in siderophore biosynthesis. This family includes L-ornithine 5-monooxygenase, which catalyses the hydroxylation of L-ornithine at the N5 position [ (PUBMED:8106324) ], and L-lysine 6-monooxygenase, which catalyses the hydroxylation of lysine at the N6 position [ (PUBMED:16461464) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry K_oxygenase