The domain within your query sequence starts at position 144 and ends at position 295; the E-value for the Katanin_con80 domain shown below is 1.1e-44.
QDHETMAQVLFSRNLRLNVALTFWRKRSISELVAYLVRIEDLGVVVDCLPVLTNSLQEEK QYISLGCCVDLLPLVKSLLQSRFEEYVIVGLNWLQAVIKRWWSELSSTSEIISDGNIKIL KQQLSGLWEQESHLTLVPGYTGNIAKDVDAYL
Katanin_con80 |
---|
PFAM accession number: | PF13925 |
---|---|
Interpro abstract (IPR028021): | This entry represents the C-terminal domain of katanin 80kDa subunit. Katanin is a microtubule-severing protein consist of a 60kDa ATPase subunit (katanin-p60) and a 80kDa subunit (katanin-p80) [ (PUBMED:8221885) ]. Katanin-p80 is composed of an N-terminal WD40 repeat domain, a central proline-rich domain and a C-terminal domain required for dimerisation with the catalytic katanin-p60. The katanin complex associates with a specific subregion of the mitotic spindle leading to increased microtubule disassembly and targeting of katanin-p60 to the spindle poles [ (PUBMED:10751153) ]. It was suggested that katanin is targeted to spindle poles through a combination of direct microtubule binding by the katanin-p60 and through interactions between the WD40 domain and an unknown protein [ (PUBMED:17846175) ]. |
GO function: | microtubule binding (GO:0008017) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Katanin_con80