The domain within your query sequence starts at position 496 and ends at position 654; the E-value for the Katanin_con80 domain shown below is 8.2e-59.

KGHDTMFVVLTSRHKNLDTVRAVWTTGDIKTSVDSAVAINDLSVVVDLLNIVNQKASLWK
LDLCTTVLPQIEKLLQSKYESYVQTGCTSLKLILQRFLPLITDILAAPPSVGVDISREER
LHKCRLCFKQLKSISGLVKSKSGLSGRHGSAFRELHLLM

Katanin_con80

Katanin_con80
PFAM accession number:PF13925
Interpro abstract (IPR028021):

This entry represents the C-terminal domain of katanin 80 kDa subunit. Katanin is a microtubule-severing protein consist of a 60 kDa ATPase subunit (katanin-p60) and a 80 kDa subunit (katanin-p80) [(PUBMED:8221885)]. Katanin-p80 is composed of an N-terminal WD40 repeat domain, a central proline-rich domain and a C-terminal domain required for dimerisation with the catalytic katanin-p60. The katanin complex associates with a specific subregion of the mitotic spindle leading to increased microtubule disassembly and targeting of katanin-p60 to the spindle poles [(PUBMED:10751153)]. It was suggested that katanin is targeted to spindle poles through a combination of direct microtubule binding by the katanin-p60 and through interactions between the WD40 domain and an unknown protein [(PUBMED:17846175)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Katanin_con80