The domain within your query sequence starts at position 1 and ends at position 32; the E-value for the KcnmB2_inactiv domain shown below is 3.7e-26.

MFIWTSGRTSSSYRQDEKRNIYQKIRDHDLLD

KcnmB2_inactiv

 KcnmB2_inactiv
PFAM accession number:PF09303
Interpro abstract (IPR015382):

This domain is found in the cytoplasmic N terminus of KCNMB2, the beta-2 subunit of large conductance calcium and voltage-activated potassium channels. It is responsible for the fast inactivation of these channels [ (PUBMED:11517232) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry KcnmB2_inactiv