The domain within your query sequence starts at position 14 and ends at position 142; the E-value for the Keratin_2_head domain shown below is 4.7e-37.

GFSSGSAIAGGVKRVAFSSGSMSGGAGRCSSGGFGSRSLYNLGGHKSISMSVAGSCQGGG
YGGAGGFGVGGYGAGFGAGGFGGGFGGSFNGRGGPGFPVCPAGGIQEVTINQSLLTPLQV
EIDPEIQKI

Keratin_2_head

Keratin_2_head
PFAM accession number:PF16208
Interpro abstract (IPR032444):

All intermediate filament proteins feature a central alpha-helical rod domain and variable nonhelical domains located at the N-terminal (head) and C-terminal (tail). The central rod domain is the main driver of self-assembly into filaments, whereas the N- and C-terminal domains are involved in post-translational modifications and interactions with other proteins [(PUBMED:16710422)]. Type I and type II keratin form heteropolymeric intermediate filaments providing vital mechanical support in epithelia [(PUBMED:22705788)]. This entry represents the N-terminal domain (head) of type II keratins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Keratin_2_head