The domain within your query sequence starts at position 28 and ends at position 122; the E-value for the Keratin_B2 domain shown below is 3.2e-42.
SCCETSCFQPSCCGTGYGIGGGIGCGQEGGFGGVSCRVRWCRPDCRVEGTCLPPCCVVSC IPPTCCQLHHAQASCCRPSYCGQSCCRPACCCYCC
Keratin_B2 |
---|
PFAM accession number: | PF01500 |
---|---|
Interpro abstract (IPR002494): | Keratin-associated proteins (KAPs) are cysteine-rich proteins synthesized during the differentiation of hair matrix cells, and form hair fibres in association with hair keratin intermediate filaments [ (PUBMED:9524245) (PUBMED:2250030) ]. This entry also includes the high-sulfur and high-tyrosine keratins from sheep and goats. In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins, which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins [ (PUBMED:14962103) ]. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins. |
GO component: | keratin filament (GO:0045095) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Keratin_B2