The domain within your query sequence starts at position 126 and ends at position 301; the E-value for the Kinase-like domain shown below is 1.6e-7.

MDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLH
DRGHYVLCDFGSATNKFQNPQAEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADI
WALGCLLYKLCYFTLPFGESQVAICDGSFTIPDNSRYSQDMHCLIRYMLEPDPDKR

Kinase-like

Kinase-like
PFAM accession number:PF14531
Interpro abstract (IPR027916):

This entry represents the kinase-like domain found in the Rhoptry (ROP) pseudokinases from the intracellular parasite Toxoplasma gondii [(PUBMED:23742205)]. ROP2, ROP4 and ROP8 have a typical bi-lobed protein kinase fold, but lack catalytic activity [(PUBMED:19197235)].

ROP4 is localised to the rhoptries, secretory organelles at the apical end of the parasite, and is secreted from the parasite during host cell invasion [(PUBMED:15470260)]. ROP2 mediates an association between the parasitophorous vacuole (PV) and host cell mitochondria by inserting into the parasitophorous vacuole membrane (PVM) [(PUBMED:11448993)]. It plays important roles in rhoptry biogenesis, parasite invasion, and intracellular replication [(PUBMED:12711703)]. During host invasion, ROP2 is released from the vacuole membrane and becomes phosphorylated in the infected cells [(PUBMED:11448993)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Kinase-like