The domain within your query sequence starts at position 41 and ends at position 116; the E-value for the Kisspeptin domain shown below is 7.1e-35.
NAWEKESRYAESKPGSAGLRARRSSPCPPVEGPAGRQRPLCASRSRLIPAPRGAVLVQRE KDLSTYNWNSFGLRYG
Kisspeptin |
---|
PFAM accession number: | PF15152 |
---|---|
Interpro abstract (IPR020207): | Kisspeptin (KiSS-1) is a metastasis suppressor protein found in malignant melanomas and in some breast cancers [ (PUBMED:18583061) ]. KiSS-1 may regulate events downstream of cell-matrix adhesion, which could involve cytoskeletal reorganisation. KiSS-1 generates a C-terminally amidated peptide, metastin, which functions as the endogenous ligand of the G-protein coupled receptor GPR54. Activation of the receptor inhibits cell proliferation and cell migration, key characteristics of tumour metastasis. Kp-10 is a decapeptide derived from the primary translation product, isolated in conditioned medium of first trimester trophoblast [ (PUBMED:16288036) (PUBMED:17351756) ]. Kp-10, but not other kisspeptins, increased intracellular Ca2+ levels in isolated first trimester trophoblasts. Kp-10 is a paracrine/endocrine regulator in fine-tuning trophoblast invasion generated by the trophoblast itself. The receptor is also essential for normal gonadotropin-released hormone physiology and for puberty. The hypothalamic KiSS1/GPR54 system is a pivotal factor in central regulation of the gonadotropic axis at puberty and in adulthood [ (PUBMED:15684075) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Kisspeptin