The domain within your query sequence starts at position 207 and ends at position 317; the E-value for the Kri1 domain shown below is 4.4e-27.

RRKDERRKEKREETRERKKREKARKQEELKQLKNLKRKEILAKLEKLRQATGNETLGLEE
QDLEADFDPAQHDQLMQKCFGDAFYGTAEEEKPQFEEEDGLEDDWNWDMWG

Kri1

Kri1
PFAM accession number:PF05178
Interpro abstract (IPR018034): The budding yeast KRR1-interacting protein 1 (Kri1) is an essential nucleolar protein required for 40S ribosome biogenesis [(PUBMED:11027267)]. This entry also includes Kri1 homologues from animals and plants. Their function is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Kri1