The domain within your query sequence starts at position 207 and ends at position 317; the E-value for the Kri1 domain shown below is 4.4e-27.
RRKDERRKEKREETRERKKREKARKQEELKQLKNLKRKEILAKLEKLRQATGNETLGLEE QDLEADFDPAQHDQLMQKCFGDAFYGTAEEEKPQFEEEDGLEDDWNWDMWG
Kri1 |
 |
|---|
| PFAM accession number: | PF05178 |
|---|---|
| Interpro abstract (IPR018034): | The budding yeast KRR1-interacting protein 1 (Kri1) is an essential nucleolar protein required for 40S ribosome biogenesis [ (PUBMED:11027267) ]. This entry also includes Kri1 homologues from animals and plants. Their function is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Kri1