The domain within your query sequence starts at position 35 and ends at position 205; the E-value for the Ku_N domain shown below is 1.2e-59.
SLIFLVDASRAMFESQGEDELTPFDMSIQCIQSVYTSKIISSDRDLLAVVFYGTEKDKNS VNFKNIYVLQDLDNPGAKRVLELDQFKGQQGKKHFRDTVGHGSDYSLSEVLWVCANLFSD VQLKMSHKRIMLFTNEDDPHGRDSAKASRARTKASDLRDTGTSSPPLRTRT
Ku_N |
---|
PFAM accession number: | PF03731 |
---|---|
Interpro abstract (IPR005161): | The Ku heterodimer (composed of Ku70 P12956 and Ku80 P13010 ) contributes to genomic integrity through its ability to bind DNA double-strand breaks and facilitate repair by the non-homologous end-joining pathway. This is the N-terminal alpha/beta domain. This domain only makes a small contribution to the dimer interface. The domain comprises a six stranded beta sheet of the Rossman fold [ (PUBMED:10191092) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ku_N