SMART: Pfam domain Ku_PK

The domain within your query sequence starts at position 594 and ends at position 707; the E-value for the Ku_PK_bind domain shown below is 9.3e-31.

NPVENFRFLVRQKIASFEEASLQLISHIEQFLDTNETLYFMKSMDCIKAFREEAIQFSEE
QRFNSFLEALREKVEIKQLNHFWEIVVQDGVTLITKDEGPGSSITAEEATKFLA

Ku_PK_bind

PFAM accession number:	PF08785
Interpro abstract (IPR014893):	The non-homologous end joining (NHEJ) pathway is one method by which double stranded breaks in chromosomal DNA are repaired. Ku is a component of a multi-protein complex that is involved in the NHEJ. Ku has affinity for DNA ends and recruits the DNA-dependent protein kinase catalytic subunit (DNA-PKcs). Ku also binds RNA, mediating the assembly of DNA-PKcs which has a role in ribosomal RNA biogenesis [ (PUBMED:32103174) ]. This domain is found at the C-terminal of Ku which binds to DNA-PKcs [ (PUBMED:14672664) ].

PFAM accession number:

PF08785

Interpro abstract (IPR014893):

The non-homologous end joining (NHEJ) pathway is one method by which double stranded breaks in chromosomal DNA are repaired. Ku is a component of a multi-protein complex that is involved in the NHEJ. Ku has affinity for DNA ends and recruits the DNA-dependent protein kinase catalytic subunit (DNA-PKcs). Ku also binds RNA, mediating the assembly of DNA-PKcs which has a role in ribosomal RNA biogenesis [ (PUBMED:32103174) ]. This domain is found at the C-terminal of Ku which binds to DNA-PKcs [ (PUBMED:14672664) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ku_PK_bind