The domain within your query sequence starts at position 2878 and ends at position 2932; the E-value for the Kunitz_BPTI domain shown below is 1.1e-19.
LCSLPLDEGSCTAYTLRWYHRAVPGGTACHPFVYGGCGGNANRFGTREACERRCP
Kunitz_BPTI |
---|
PFAM accession number: | PF00014 |
---|---|
Interpro abstract (IPR002223): | The majority of the sequences having this domain belong to the MEROPS inhibitor family I2, clan IB; the Kunitz/bovine pancreatic trypsin inhibitor family, they inhibit proteases of the S1 family [ (PUBMED:14705960) ] and are restricted to the metazoa with a single exception: Amsacta moorei entomopoxvirus. They are short (~50 residue) alpha/beta proteins with few secondary structures. The fold is constrained by 3 disulphide bonds. The type example for this family is aprotinin (bovine pancreatic trypsin inhibitor) [ (PUBMED:1714504) ] (or basic protease inhibitor), but the family includes numerous other members [ (PUBMED:1703675) (PUBMED:1593645) (PUBMED:8159751) (PUBMED:1304909) ], such as snake venom basic protease; mammalian inter-alpha-trypsin inhibitors; trypstatin, a rodent mast cell inhibitor of trypsin; a domain found in an alternatively-spliced form of Alzheimer's amyloid beta-protein; domains at the C-termini of the alpha(1) and alpha(3) chains of type VII and type VI collagens; and tissue factor pathway inhibitor precursor. The pancreatic trypsin inhibitor (Kunitz) family [ (PUBMED:6996568) (PUBMED:1703675) (PUBMED:1593645) ] is one of the numerous families of serine proteinase inhibitors. The basic structure of such a type of inhibitor is shown in the following schematic representation:
|
GO function: | serine-type endopeptidase inhibitor activity (GO:0004867) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Kunitz_BPTI