The domain within your query sequence starts at position 12 and ends at position 99; the E-value for the KxDL domain shown below is 1.3e-40.

CGRFLSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSVRLQQMSERFMHHTRTLV
DMKRDLDSIFRRIRTLKGKLARQHPEAF

KxDL

KxDL
PFAM accession number:PF10241
Interpro abstract (IPR019371):

This entry represents a conserved region of 80 residues which defines a family of short proteins. There is a characteristic KxDL motif towards the C terminus. The function is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry KxDL