The domain within your query sequence starts at position 1 and ends at position 59; the E-value for the LAP1C domain shown below is 4e-22.

XPAEVYGDFEPRAAKERSPGGRRTPPEKFRPASAGEEVRESAYNLRSRPRRQRRAQEAE

LAP1C

LAP1C
PFAM accession number:PF05609
Interpro abstract (IPR008662):

This entry contains Rattus norvegicus LAP1C proteins and several uncharacterised highly related sequences from both Mus sp. and humans. Lamina-associated polypeptide 1s (LAP1s), also known as Torsin-1A-interacting protein 1, are type 2 integral membrane proteins with a single membrane-spanning region of the inner nuclear membrane [ (PUBMED:12061773) ]. LAP1s bind to both A- and B-type lamins and have a putative role in the membrane attachment and assembly of the nuclear lamina [ (PUBMED:7721789) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LAP1C