The domain within your query sequence starts at position 459 and ends at position 692; the E-value for the LAP2alpha domain shown below is 6.4e-155.
AKSVVSHSLTTLGVEVSKPPPQHDKIEASEPSFPLHESILKVVEEEWQQIDRQLPSVACR YPVSSIEAARILSVPKVDDEILGFISEATPRAATQASSTESCDKHLDLALCRSYEAAASA LQIAAHTAFVAKSLQADISQAAQIINSDPSDAQQALRILNRTYDAASYLCDAAFDEVRMS ACAMGSSTMGRRYLWLKDCKISPASKNKLTVAPFKGGTLFGGEVHKVIKKRGNK
LAP2alpha |
---|
PFAM accession number: | PF11560 |
---|---|
Interpro abstract (IPR021623): | LAPs are components of the nuclear lamina which supports the nuclear envelope. LAP2alpha is a non-membrane-associated member of the LAP family which is unique. This entry represents the C-terminal domain of LAP2alpha which consists of residues 459-693 and constitutes a dimeric structure with an antiparallel coiled coil. LAP2alpha is involved in cell-cycle regulation and chromatin organisation and preferentially binds to lamin A/C [ (PUBMED:17562312) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LAP2alpha