The domain within your query sequence starts at position 459 and ends at position 692; the E-value for the LAP2alpha domain shown below is 6.4e-155.

AKSVVSHSLTTLGVEVSKPPPQHDKIEASEPSFPLHESILKVVEEEWQQIDRQLPSVACR
YPVSSIEAARILSVPKVDDEILGFISEATPRAATQASSTESCDKHLDLALCRSYEAAASA
LQIAAHTAFVAKSLQADISQAAQIINSDPSDAQQALRILNRTYDAASYLCDAAFDEVRMS
ACAMGSSTMGRRYLWLKDCKISPASKNKLTVAPFKGGTLFGGEVHKVIKKRGNK

LAP2alpha

LAP2alpha
PFAM accession number:PF11560
Interpro abstract (IPR021623):

LAPs are components of the nuclear lamina which supports the nuclear envelope. LAP2alpha is a non-membrane-associated member of the LAP family which is unique. This entry represents the C-terminal domain of LAP2alpha which consists of residues 459-693 and constitutes a dimeric structure with an antiparallel coiled coil. LAP2alpha is involved in cell-cycle regulation and chromatin organisation and preferentially binds to lamin A/C [(PUBMED:17562312)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LAP2alpha