The domain within your query sequence starts at position 161 and ends at position 235; the E-value for the LAS2 domain shown below is 2.8e-26.

SSDIKNSPSFYVDATSKSKNNIVPPYVYTNINGKKCGRPRTPKPINRENKCVSESSLSFP
KESSFTEDSAERRLE

LAS2

LAS2
PFAM accession number:PF15792
Interpro abstract (IPR031587):

LAS2 is a family of eukaryotic proteins. Deletion of LAS2 is observed in approx. 40% of human lung adenocarcinomas, suggesting that loss of function of LAS2 may be a key step for promoting lung tumourigenesis [(PUBMED:19622765)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LAS2