The domain within your query sequence starts at position 29 and ends at position 197; the E-value for the LAT2 domain shown below is 6.6e-82.
CSRPGVKRNEKIYEQRNRQENAQSSAAAQTYSLARQVWPGPQMDTAPNKSFERKNKMLFS HLEGPESPRYQNFYKGSNQEPDAAYVDPIPTNYYNWGCFQKPSEDDDSNSYENVLVCKPS TPESGVEDFEDYQNSVSIHQWRESKRTMGAPMSLSGSPDEEPDYVNGDV
LAT2 |
---|
PFAM accession number: | PF15703 |
---|---|
Interpro abstract (IPR031428): | The adaptor protein linker activator of T-cells 2 (LAT2), also called non-T-cell activation linker (NTAL), linker activator for B-cells (LAB) or Williams Beuren Syndrome critical region 5 (WBSCR5), is expressed in various myeloid and lymphoid cells [ (PUBMED:16160011) ]. Given the wide expression pattern, it may modulate signalling in most types of leukocytes [ (PUBMED:20643813) ]. It has been shown to be involved in immunoreceptor signaling [ (PUBMED:12486104) ], B cell activation [ (PUBMED:12514734) ], negative regulation of T cell activation [ (PUBMED:17081783) ], and regulation of mast cell physiology [ (PUBMED:25153696) ]. |
GO process: | immune response-regulating signaling pathway (GO:0002764), B cell activation (GO:0042113) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LAT2