The domain within your query sequence starts at position 27 and ends at position 378; the E-value for the LAX domain shown below is 2.4e-172.

LQGEKGQIIFPGFVVLLTIILVIIAACILWSWKKQKKRPVPYFQVAPSLTLPPPRHRAKN
IYDFLPRQQTELGRHQLSGFSTESLLSRASDSPEPEAPQANGSLQMHRVSVHTVEYSVNI
YDNGTVPQMCRHLASSTHHVCVRTSRSNPSISSKESNDYVNIPTVEDTCETLTRIESTPE
NHLGLPSALRLEFAEGGHAGCGNATDHDGFWAPGPKCSDSLSDGDDLSQTSNDYVNMTGL
DLENIQENRPRGAFQCCRDYENVPWVDTNESQLPTLEEVASSTVDHREPVWRTLSSVYHM
AFQPSAQSEDSAMVHREEQSSEDSSDYETVLVAELEGRDWKQGPGTQHPSDE

LAX

LAX
PFAM accession number:PF15681
Interpro abstract (IPR031393):

LAX is a family of proteins is found in chordates. LAX is membrane-associated and expressed in B cells, T cells, and other lymphoid-specific cell types. It down-regulates antigen-receptor signalling in T cells by inhibiting TCR-mediated p38 MAPK activation [(PUBMED:12359715), (PUBMED:15843560)].

GO process:immune response (GO:0006955), regulation of lymphocyte activation (GO:0051249)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LAX