The domain within your query sequence starts at position 72 and ends at position 399; the E-value for the LCAT domain shown below is 6.2e-84.

YFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSK
RNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGP
VVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVI
GPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMR
QDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQC
QAWQSRQEHRVSLQELPGSEHIEMLANA

LCAT

LCAT
PFAM accession number:PF02450
Interpro abstract (IPR003386):

Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (EC 2.3.1.43), is involved in extracellular metabolism of plasma lipoproteins, including cholesterol. It esterifies the free cholesterol transported in plasma lipoproteins, and is activated by apolipoprotein A-I. Defects in LACT cause Norum and Fish eye diseases.

This family also includes phospholipid:diacylglycerol acyltransferase (PDAT)(EC 2.3.1.158), which is involved in triacylglycerol formation by an acyl-CoA independent pathway. The enzyme specifically transfers acyl groups from the sn-2 position of a phospholipid to diacylglycerol, thus forming an sn-1-lysophospholipid [(PUBMED:12963726)].

GO process:lipid metabolic process (GO:0006629)
GO function:O-acyltransferase activity (GO:0008374)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LCAT