The domain within your query sequence starts at position 1 and ends at position 81; the E-value for the LCE6A domain shown below is 4.2e-46.
MSQQKPQLSELPNAPIYSPPKGPNLSLSTCSTSCGTSCSAGCSSYSKRLRLQNTVSHKEI HHPQPRCLRGSTTYHCKEEEC
LCE6A |
 |
|---|
| PFAM accession number: | PF15858 |
|---|---|
| Interpro abstract (IPR031716): | LCE6A, late cornified envelope protein 6A, is found in mammals. It was identified in a large-scale screening experiment as being involved in the barrier function of the epidermis [ (PUBMED:17562024) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LCE6A