The domain within your query sequence starts at position 468 and ends at position 569; the E-value for the LEDGF domain shown below is 2.8e-31.

ERLQKLHSEIKFALKVDNPDVRKCLSALEELGTLQVTSQILQKNTDVVATLKKIRRYKAN
KDVMAKAAEVYTRLKSRVLGPKVEALQKVNKAGAEKERADNE

LEDGF

LEDGF
PFAM accession number:PF11467
Interpro abstract (IPR021567):

Lens epithelium-derived growth factor (LEDGF), also known as transcriptional co-activator p75, is a chromatin-associated protein that protects cells from stress-induced apoptosis. It is the binding partner of HIV-1 integrase in human cells [(PUBMED:15371438)]. The integrase binding domain (IBD) of LEDGF is a compact right-handed bundle composed of five alpha-helices. The residues essential for the interaction with the integrase are present in the inter-helical loop regions of the bundle structure. The integrase binding domain is not unique to LEDGF, as a second human protein, hepatoma-derived growth factor-related protein 2 (HRP2), contains a homologous sequence [(PUBMED:15371438)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LEDGF