The domain within your query sequence starts at position 24 and ends at position 189; the E-value for the LIME1 domain shown below is 5.4e-74.

GIQEALTRNTGRKRAQRQQTGLQDSLVPVEMPLLRQTHLCSLSKSDTRLHELHRGPRSSI
APRPASMDLLHPRWLEMSRGSTRSQVPNSAFPPRQLPRAPPAAPATAPSTSSEATYSNVG
LAAIPRASLAASPVVWAGTQLTISCARLGPGAEYACIQKHKGTEQG

LIME1

 LIME1
PFAM accession number:PF15332
Interpro abstract (IPR026072):

Lime is involved in BCR (B-cell antigen receptor)-mediated signaling in B-cells and TCR (T-cell antigen receptor)-mediated T-cell signaling in T-cells. It couples activation of these receptors and their associated kinases with distal intracellular events such as calcium mobilisation or MAPK activation through the recruitment of PLCG2, GRB2, GRAP2, and other signaling molecules [ (PUBMED:14610044) (PUBMED:16249387) ].

GO process:T cell receptor signaling pathway (GO:0050852), B cell receptor signaling pathway (GO:0050853)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LIME1