The domain within your query sequence starts at position 80 and ends at position 202; the E-value for the LIN37 domain shown below is 7.5e-29.

FPHQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICRAWMRNSPT
VRERERSPGSPLPPLPEDGEGSEVINSKNRDVYKLPPPTAPGPLGDACRSRIPSPLQPET
EGT

LIN37

• PFAM accession number: PF15306
• Interpro abstract (IPR028226):

  This entry represent LIN37 and related proteins from animals and plants. In humans, LIN37 is a component of the DREAM (MuvB/DRM) complex, which represses cell cycle-dependent genes in quiescent cells and plays a role in the cell cycle-dependent activation of G2/M genes [ (PUBMED:17531812) (PUBMED:17671431) ].

• GO component: transcription repressor complex (GO:0017053)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LIN37