The domain within your query sequence starts at position 18 and ends at position 112; the E-value for the LIN52 domain shown below is 1.1e-42.

LLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAEIERDDIDMLKELGSLTT
ANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILE

LIN52

LIN52
PFAM accession number:PF10044
Interpro abstract (IPR018737):

LIN52 is a component of the DREAM (MuvB/DRM) complex which represses cell cycle-dependent genes in quiescent cells and plays a role in the cell cycle-dependent activation of G2/M genes [(PUBMED:17531812), (PUBMED:17671431)].

GO process:cell cycle (GO:0007049), transcription, DNA-templated (GO:0006351)
GO component:DRM complex (GO:0070176)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LIN52