The domain within your query sequence starts at position 717 and ends at position 755; the E-value for the LINES_C domain shown below is 5e-22.
RTVKCLEELQGAIYRLQEKNLFPYNPAALLKLLKGVEAK
LINES_C |
---|
PFAM accession number: | PF14695 |
---|---|
Interpro abstract (IPR029415): | This family represents the C terminus of protein lines [ (PUBMED:12119551) ]. In Drosophila, this protein is involved in embryonic segmentation and may function as a transcriptional regulator [ (PUBMED:8241770) (PUBMED:11846473) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LINES_C