The domain within your query sequence starts at position 723 and ends at position 759; the E-value for the LINES_C domain shown below is 2.4e-21.

TVKCLEELQGAIYRLQEKNLFPYNPAALLKLLKGVEA

LINES_C

 LINES_C
PFAM accession number:PF14695
Interpro abstract (IPR029415):

This family represents the C terminus of protein lines [ (PUBMED:12119551) ]. In Drosophila, this protein is involved in embryonic segmentation and may function as a transcriptional regulator [ (PUBMED:8241770) (PUBMED:11846473) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LINES_C